TSLP (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9281
Article Name: TSLP (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9281
Supplier Catalog Number: P9281
Alternative Catalog Number: ABN-P9281-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human TSLP recombinant protein expressed in Escherichia coli.
UniProt: 85480
Buffer: Protein (1 mg/mL) was lyophilized from a solution containing 20 mM sodium phosphate, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Target: TSLP