TSLP (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: TSLP (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9282
• Supplier Catalog Number: P9282
• Alternative Catalog Number: ABN-P9282-2
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Human

Product Description

Human TSLP partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Product Properties

• Tag: His
• UniProt: 85480
• Buffer: Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH2O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
• Form: Lyophilized
• Sequence: MKHHHHHHASYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Target: TSLP