Thpo (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P9290
Article Name: Thpo (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9290
Supplier Catalog Number: P9290
Alternative Catalog Number: ABN-P9290-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Mouse
Mouse Thpo recombinant protein with expressed in Escherichia coli.
UniProt: 21832
Buffer: Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Target: Thpo