VEGFA (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9300
| Article Name: |
VEGFA (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9300 |
| Supplier Catalog Number: |
P9300 |
| Alternative Catalog Number: |
ABN-P9300-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human VEGFA recombinant protein expressed in?Escherichia coli. |
| UniProt: |
7422 |
| Buffer: |
Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Target: |
VEGFA |
