VEGFA (Human) Recombinant Protein
Catalog Number:
ABN-P9303
| Article Name: |
VEGFA (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P9303 |
| Supplier Catalog Number: |
P9303 |
| Alternative Catalog Number: |
ABN-P9303-2 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human VEGFA partial recombinant protein expressed in HEK293 cells. |
| UniProt: |
7422 |
| Buffer: |
Lyophilized from a solution containing 20 mM PB, pH 7.2, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Target: |
VEGFA |
