VEGFA (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9306
Article Name: VEGFA (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9306
Supplier Catalog Number: P9306
Alternative Catalog Number: ABN-P9306-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human VEGFA recombinant protein expressed in Escherichia coli.
UniProt: 7422
Buffer: Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Target: VEGFA