VEGFA (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9306
Article Name: |
VEGFA (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9306 |
Supplier Catalog Number: |
P9306 |
Alternative Catalog Number: |
ABN-P9306-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA |
Species Reactivity: |
Human |
Human VEGFA recombinant protein expressed in Escherichia coli. |
UniProt: |
7422 |
Buffer: |
Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR |
Target: |
VEGFA |