VEGFA (Equine) Recombinant Protein, E. coli
Catalog Number:
ABN-P9320
| Article Name: |
VEGFA (Equine) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9320 |
| Supplier Catalog Number: |
P9320 |
| Alternative Catalog Number: |
ABN-P9320-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Equine Vegfa recombinant protein expressed in?Escherichia coli. |
| UniProt: |
100033839 |
| Buffer: |
Lyophilized from a solution containing 10 mM Sodium Phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 0.1 mg/mL. |
| Form: |
Lyophilized |
| Sequence: |
MAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Target: |
LOC100033839 |
