Vegfa (Rat) Recombinant Protein, Insect
Catalog Number:
ABN-P9324
| Article Name: |
Vegfa (Rat) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P9324 |
| Supplier Catalog Number: |
P9324 |
| Alternative Catalog Number: |
ABN-P9324-2 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Rat |
| Rat Vegfa recombinant proteind with His tag in C-terminus expressed in Insect Cells. |
| Tag: |
His |
| UniProt: |
83785 |
| Buffer: |
Lyophilized from a solution containing 1XPBS, 50 mg BSA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH |
| Target: |
Vegfa |
