MLANA (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9403
Article Name: MLANA (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9403
Supplier Catalog Number: P9403
Alternative Catalog Number: ABN-P9403-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human MLANA (Q16655, 48 a.a. - 118 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 2315
Buffer: In 20mM Tris-HCl pH 8.0 (0.15 M NaCl, 1 mM DTTa and 20% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Target: MLANA
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.