SFTPB (Human) Recombinant Protein, Mammal
Catalog Number:
ABN-P9409
| Article Name: |
SFTPB (Human) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P9409 |
| Supplier Catalog Number: |
P9409 |
| Alternative Catalog Number: |
ABN-P9409-2 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
| Tag: |
His |
| UniProt: |
6439 |
| Buffer: |
Lyophilized from sterile distilled Water |
| Form: |
Lyophilized |
| Sequence: |
WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCS |
| Target: |
SFTPB |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
