CCL27 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9428
| Article Name: |
CCL27 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9428 |
| Supplier Catalog Number: |
P9428 |
| Alternative Catalog Number: |
ABN-P9428-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in Escherichia coli. |
| UniProt: |
10850 |
| Buffer: |
In 10mM sodium citrate pH 3.5 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
| Target: |
CCL27 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
