CXCL5 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9435
Article Name: CXCL5 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9435
Supplier Catalog Number: P9435
Alternative Catalog Number: ABN-P9435-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL5 (P42830, 41 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6374
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Target: CXCL5
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.