CXCL5 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9437
Article Name: CXCL5 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9437
Supplier Catalog Number: P9437
Alternative Catalog Number: ABN-P9437-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL5 (P42830, 8 a.a. - 78 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6374
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Target: CXCL5
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.