Ccl11 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9442
Article Name: Ccl11 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9442
Supplier Catalog Number: P9442
Alternative Catalog Number: ABN-P9442-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Ccl11 (P97545, 24 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 29397
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
Target: Ccl11
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.