Cx3cl1 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9455
Article Name: Cx3cl1 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9455
Supplier Catalog Number: P9455
Alternative Catalog Number: ABN-P9455-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Cx3cl1 (O55145, 25 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 89808
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG
Target: Cx3cl1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.