CXCL6 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9457
Article Name: CXCL6 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9457
Supplier Catalog Number: P9457
Alternative Catalog Number: ABN-P9457-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL6 (P80162, 43 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6372
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Target: CXCL6
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.