CXCL1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9459
Article Name: CXCL1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9459
Supplier Catalog Number: P9459
Alternative Catalog Number: ABN-P9459-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 2919
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Target: CXCL1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.