CXCL1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9460
Article Name: CXCL1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9460
Supplier Catalog Number: P9460
Alternative Catalog Number: ABN-P9460-50
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 2919
Buffer: In 20mM Tris-HCl pH 8.0 (10% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Target: CXCL1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.