Cxcl1 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9463
Article Name: Cxcl1 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9463
Supplier Catalog Number: P9463
Alternative Catalog Number: ABN-P9463-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Cxcl1 (P14095, 25 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 81503
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Target: Cxcl1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.