CXCL2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9464
Article Name: CXCL2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9464
Supplier Catalog Number: P9464
Alternative Catalog Number: ABN-P9464-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 2920
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Target: CXCL2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.