CXCL2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9465
Article Name: CXCL2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9465
Supplier Catalog Number: P9465
Alternative Catalog Number: ABN-P9465-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 2920
Buffer: In 20mM Tris-HCl pH 8.0
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Target: CXCL2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.