Cxcl2 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9467
Article Name: Cxcl2 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9467
Supplier Catalog Number: P9467
Alternative Catalog Number: ABN-P9467-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Cxcl2 (P30348, 28 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 114105
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Target: Cxcl2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.