CXCL3 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9469
Article Name: CXCL3 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9469
Supplier Catalog Number: P9469
Alternative Catalog Number: ABN-P9469-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL3 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 2921
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Target: CXCL3
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.