Cxcl3 (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P9472
Article Name: |
Cxcl3 (Mouse) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9472 |
Supplier Catalog Number: |
P9472 |
Alternative Catalog Number: |
ABN-P9472-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Mouse Cxcl3 (Q6W5C0, 32 a.a. - 100 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
330122 |
Buffer: |
In 20mM Tris-HCl pH 8.0 (5 M DTT, 0.15 M NaCl and 50% glycerol) |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Target: |
Cxcl3 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |