Cxcl10 (Guinea Pig) Recombinant Protein, E. coli
Catalog Number:
ABN-P9494
| Article Name: |
Cxcl10 (Guinea Pig) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9494 |
| Supplier Catalog Number: |
P9494 |
| Alternative Catalog Number: |
ABN-P9494-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Guinea Pig Cxcl10 (A0A286XCT1, 22 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli. |
| UniProt: |
100714889 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
IPHSRTIRCTCIETSTQPVNPKSFKKLEIIPASQSCPRVEIIATMKMNGEKRCLDPESKVIKNLLKAVRKERSKRS |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
