CXCL11 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9496
Article Name: |
CXCL11 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9496 |
Supplier Catalog Number: |
P9496 |
Alternative Catalog Number: |
ABN-P9496-20 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
6373 |
Buffer: |
In 10mM Sodium citrate pH 3.5 (2 mM DTT and 20% glycerol) |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Target: |
CXCL11 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |