CXCL11 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9496
Article Name: CXCL11 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9496
Supplier Catalog Number: P9496
Alternative Catalog Number: ABN-P9496-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6373
Buffer: In 10mM Sodium citrate pH 3.5 (2 mM DTT and 20% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Target: CXCL11
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.