CCL28 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9527
| Article Name: |
CCL28 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9527 |
| Supplier Catalog Number: |
P9527 |
| Alternative Catalog Number: |
ABN-P9527-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CCL28 (Q9NRJ3, 23 a.a. - 127 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
56477 |
| Buffer: |
In 10mM Sodium citrate pH 3.5 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| Target: |
CCL28 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
