Ccl28 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9529
Article Name: Ccl28 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9529
Supplier Catalog Number: P9529
Alternative Catalog Number: ABN-P9529-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Rat Ccl28 (Q91Y39, 20 a.a. - 135 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 114492
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR
Target: Ccl28
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.