CXCL9 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9530
Article Name: CXCL9 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9530
Supplier Catalog Number: P9530
Alternative Catalog Number: ABN-P9530-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 4283
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDS_x005FADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Target: CXCL9
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.