CXCL9 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9531
Article Name: CXCL9 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9531
Supplier Catalog Number: P9531
Alternative Catalog Number: ABN-P9531-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 4283
Buffer: In 20mM Tris-HCl pH 8.0 (0.15 M NaCl and 30% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Target: CXCL9
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.