CCL19 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9545
Article Name: |
CCL19 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9545 |
Supplier Catalog Number: |
P9545 |
Alternative Catalog Number: |
ABN-P9545-20 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human CCL19 (Q99731, 22 a.a. - 98 a.a.) partial recombinant protein with T7 tag at N-terminus expressed in Escherichia coli. |
Tag: |
T7 |
UniProt: |
6363 |
Buffer: |
In PBS pH 7.4 (10% glycerol) |
Form: |
Liquid |
Sequence: |
MASMTGGQQMGRGSHMGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
Target: |
CCL19 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |