CCL19 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9545
| Article Name: |
CCL19 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9545 |
| Supplier Catalog Number: |
P9545 |
| Alternative Catalog Number: |
ABN-P9545-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CCL19 (Q99731, 22 a.a. - 98 a.a.) partial recombinant protein with T7 tag at N-terminus expressed in Escherichia coli. |
| Tag: |
T7 |
| UniProt: |
6363 |
| Buffer: |
In PBS pH 7.4 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MASMTGGQQMGRGSHMGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Target: |
CCL19 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
