CCL20 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9547
Article Name: CCL20 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9547
Supplier Catalog Number: P9547
Alternative Catalog Number: ABN-P9547-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 6364
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Target: CCL20
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.