PPBP (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9554
Article Name: PPBP (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9554
Supplier Catalog Number: P9554
Alternative Catalog Number: ABN-P9554-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human PPBP (P02775, 59 a.a. - 128 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 5473
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Target: PPBP
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.