PF4 (Human) Recombinant Protein

Catalog Number: ABN-P9557
Article Name: PF4 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P9557
Supplier Catalog Number: P9557
Alternative Catalog Number: ABN-P9557-20
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human PF4 (P02776, 32 a.a. - 101 a.a.) partial recombinant protein expressed in human platelets.
UniProt: 5196
Buffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Form: Lyophilized
Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Target: PF4
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.