PF4 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9559
| Article Name: |
PF4 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9559 |
| Supplier Catalog Number: |
P9559 |
| Alternative Catalog Number: |
ABN-P9559-5 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human PF4 (P02776, 32 a.a. - 101 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
5196 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
MHHHHHHEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES |
| Target: |
PF4 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
