PF4 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9559
Article Name: |
PF4 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9559 |
Supplier Catalog Number: |
P9559 |
Alternative Catalog Number: |
ABN-P9559-5 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human PF4 (P02776, 32 a.a. - 101 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
5196 |
Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
Form: |
Lyophilized |
Sequence: |
MHHHHHHEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES |
Target: |
PF4 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |