Pf4 (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P9561
| Article Name: |
Pf4 (Mouse) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9561 |
| Supplier Catalog Number: |
P9561 |
| Alternative Catalog Number: |
ABN-P9561-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Mouse Pf4 (Q9Z126, 30 a.a. - 105 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
56744 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
| Target: |
Pf4 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
