Ccl5 (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P9566
| Article Name: |
Ccl5 (Mouse) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9566 |
| Supplier Catalog Number: |
P9566 |
| Alternative Catalog Number: |
ABN-P9566-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Mouse Ccl5 (P30882, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli. |
| UniProt: |
20304 |
| Buffer: |
Lyophilized from sterile distilled Water is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| Target: |
Ccl5 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
