FTCD (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P9596
| Article Name: |
FTCD (Human) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P9596 |
| Supplier Catalog Number: |
P9596 |
| Alternative Catalog Number: |
ABN-P9596-20 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human FTCD (O95954, 1 a.a. - 541 a.a.) full recombinant protein with His tag at N-terminus expressed in Sf9 cells. |
| Tag: |
His |
| UniProt: |
10841 |
| Buffer: |
In 16mM HEPES buffer pH 7.6 (240 mM NaCl and 20% glycerol) |
| Form: |
Liquid |
| Sequence: |
MHHHHHHMSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALH |
| Target: |
FTCD |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
