CDKN1C (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9612
| Article Name: |
CDKN1C (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9612 |
| Supplier Catalog Number: |
P9612 |
| Alternative Catalog Number: |
ABN-P9612-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CDKN1C (P42773, 1 a.a. - 168 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
1031 |
| Buffer: |
In 20mM Tris-HCl pH 8.0 (2 mM DTT, 200 mM NaCl and 10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
| Target: |
CDKN2C |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
