CD14 (Human) Recombinant Protein
Catalog Number:
ABN-P9627
| Article Name: |
CD14 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P9627 |
| Supplier Catalog Number: |
P9627 |
| Alternative Catalog Number: |
ABN-P9627-50 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
| Tag: |
His |
| UniProt: |
929 |
| Buffer: |
Lyophilized from 1X PBS is > 100 ug/mL |
| Form: |
Lyophilized |
| Sequence: |
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCM |
| Target: |
CD14 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
