CD14 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9628
Article Name: CD14 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9628
Supplier Catalog Number: P9628
Alternative Catalog Number: ABN-P9628-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD14 (P08571, 20 a.a. - 349 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 929
Buffer: In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 30% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSTTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQ
Target: CD14
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.