CD1D (Human) Recombinant Protein, Insect

Catalog Number: ABN-P9634
Article Name: CD1D (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P9634
Supplier Catalog Number: P9634
Alternative Catalog Number: ABN-P9634-5
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD1D (P15813, 20 a.a. - 301 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 912
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGE
Target: CD1D
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.