CD5 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9643
Article Name: CD5 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9643
Supplier Catalog Number: P9643
Alternative Catalog Number: ABN-P9643-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 921
Buffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIK
Target: CD5
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.