CD7 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9649
Article Name: |
CD7 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9649 |
Supplier Catalog Number: |
P9649 |
Alternative Catalog Number: |
ABN-P9649-20 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human CD7 (P09564, 26 a.a. - 180 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: |
His |
UniProt: |
924 |
Buffer: |
In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol) |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Target: |
CD7 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |