CD8A (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P9651
Article Name: |
CD8A (Human) Recombinant Protein, Insect |
Biozol Catalog Number: |
ABN-P9651 |
Supplier Catalog Number: |
P9651 |
Alternative Catalog Number: |
ABN-P9651-2 |
Manufacturer: |
Abnova |
Host: |
Insect |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Human CD8A (P01732, 22 a.a. - 182 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: |
His |
UniProt: |
925 |
Buffer: |
In PBS pH 7.4 (10% glycerol) |
Form: |
Liquid |
Sequence: |
ADPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDHHHHHH |
Target: |
CD8A |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |