CD8B (Human) Recombinant Protein
Catalog Number:
ABN-P9652
| Article Name: |
CD8B (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P9652 |
| Supplier Catalog Number: |
P9652 |
| Alternative Catalog Number: |
ABN-P9652-20 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
| UniProt: |
926 |
| Buffer: |
In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol) |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP |
| Target: |
CD8B |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
