CD9 (Human) Recombinant Protein
Catalog Number:
ABN-P9657
| Article Name: |
CD9 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P9657 |
| Supplier Catalog Number: |
P9657 |
| Alternative Catalog Number: |
ABN-P9657-2 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
| Tag: |
His |
| UniProt: |
928 |
| Buffer: |
In PBS pH 7.4 (10% glycerol) |
| Form: |
Liquid |
| Sequence: |
DGSSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIHHHHHH |
| Target: |
CD9 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
