FCER2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9661
Article Name: FCER2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9661
Supplier Catalog Number: P9661
Alternative Catalog Number: ABN-P9661-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human FCER2 (P06734, 150 a.a. - 321 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 2208
Buffer: Lyophilized from sterile distilled Water is 0.5 mg/mL
Form: Lyophilized
Sequence: MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Target: FCER2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.