FCER2 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P9662
Article Name: FCER2 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P9662
Supplier Catalog Number: P9662
Alternative Catalog Number: ABN-P9662-5
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human FCER2 (P06734, 48 a.a. - 321 a.a.)partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 2208
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ADPDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAE
Target: FCER2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.