CD164 (Human) Recombinant Protein, Insect

Catalog Number: ABN-P9667
Article Name: CD164 (Human) Recombinant Protein, Insect
Biozol Catalog Number: ABN-P9667
Supplier Catalog Number: P9667
Alternative Catalog Number: ABN-P9667-2
Manufacturer: Abnova
Host: Insect
Category: Proteine/Peptide
Application: SDS-PAGE
Human CD164 (Q04900, 24 a.a. - 162 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 8763
Buffer: In PBS pH 7.4 (10% glycerol)
Form: Liquid
Sequence: ADPDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDHHHHHH
Target: CD164
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.